Protein Info for HEPCGN_01815 in Escherichia coli ECOR38

Name: ybiO
Annotation: mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 139 to 162 (24 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 335 to 361 (27 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 422 to 446 (25 residues), see Phobius details amino acids 466 to 488 (23 residues), see Phobius details amino acids 509 to 530 (22 residues), see Phobius details amino acids 536 to 555 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 516 to 556 (41 residues), 41.9 bits, see alignment 1.2e-14 PF00924: MS_channel_2nd" amino acids 557 to 621 (65 residues), 64.7 bits, see alignment E=1e-21 PF21082: MS_channel_3rd" amino acids 628 to 714 (87 residues), 51.4 bits, see alignment E=1.9e-17

Best Hits

Swiss-Prot: 100% identical to YBIO_ECOLI: Moderate conductance mechanosensitive channel YbiO (ybiO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0808)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (741 amino acids)

>HEPCGN_01815 mechanosensitive channel protein (Escherichia coli ECOR38)
MRWILFILFCLLGAPAHAVSIPGVTTTTTTDSTTEPAPEPDIEQKKAAYGALADVLDNDT
SRKELIDQLRTVAATPPAEPVPKIVPPTLVEEQTVLQKVTEVSRHYGEALSARFGQLYRN
ITGSPHKPFNPQTFSNALTHFSMLAVLVFGFYWLIRLCALPLYRKMGQWARQKNRERSNW
LQLPAMIIGAFIIDLLLLALTLFVGQVLSDNLNAGSRTIAFQQSLFLNAFALIEFFKAVL
RLIFCPNVAELRPFTIHDETARYWSRRLSWLSSLIGYGLIVAVPIISNQVNVQIGALANV
IIMLCMTVWALYLIFRNKKEITQHLLNFAEHSLAFFSLFIRAFALVWHWLASAYFIVLFF
FSLFDPGNSLKFMMGATVRSLAIIGIAAFVSGMFSRWLAKTITLSPHTQRNYPELQKRLN
GWLSAALKTARILTVCVAVMLLLSAWGLFDFWNWLQNGAGQKTVDILIRIALILFFSAVG
WTVLASLIENRLASDIHDRPLPSARTRTLLTLFRNALAVIISTITIMIVLSEIGVNIAPL
LAGAGALGLAISFGSQTLVKDIITGVFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVR
QDTGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKANQALKDAVAELMENEEIR
GLIIGEPNFAGIVGLSNTAFTLRVSFTTLPLKQWTVRFALDSQVKKHFDLAGVRAPVQTY
QVLPAPGATPAEPLPPGEPTL