Protein Info for HEPCGN_01630 in Escherichia coli ECOR38

Name: ybhB
Annotation: kinase inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 18 to 157 (140 residues), 193.1 bits, see alignment E=9.9e-62 PF01161: PBP" amino acids 23 to 157 (135 residues), 144.1 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 98% identical to YBHB_ECOLI: UPF0098 protein YbhB (ybhB) from Escherichia coli (strain K12)

KEGG orthology group: K06910, (no description) (inferred from 98% identity to ecw:EcE24377A_0836)

Predicted SEED Role

"UPF0098 protein ybhB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>HEPCGN_01630 kinase inhibitor (Escherichia coli ECOR38)
MKLISNDLRDGDKLPHRHVFNGMGYDGDNISPHLAWDDVPVGTKSFVVTCYDPDAPTGSG
WWHWVVVNLPADTRVLPQGFGSGLVAMPDGVLQTRTDFGKTGYDGAAPPKGETHRYIFTV
HALDVERIDVDEGASGAMVGFNVHFHSLARASITAMFS