Protein Info for HEPCGN_01525 in Escherichia coli ECOR38

Name: zitB
Annotation: CDF family zinc transporter ZitB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 83 to 109 (27 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 18 to 293 (276 residues), 339.5 bits, see alignment E=7.4e-106 PF01545: Cation_efflux" amino acids 21 to 213 (193 residues), 175.9 bits, see alignment E=4.2e-56

Best Hits

Swiss-Prot: 100% identical to ZITB_ECOLI: Zinc transporter ZitB (zitB) from Escherichia coli (strain K12)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to eco:b0752)

MetaCyc: 100% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Zinc transporter ZitB" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>HEPCGN_01525 CDF family zinc transporter ZitB (Escherichia coli ECOR38)
MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVIGGFLSGSLALLADAGHMLTDTAA
LLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVE
GGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWT
GWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVH
HVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCH
LNEGVSGHSHHHH