Protein Info for HEPCGN_01000 in Escherichia coli ECOR38

Name: ybeZ
Annotation: PhoH-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF02562: PhoH" amino acids 131 to 334 (204 residues), 329.9 bits, see alignment E=8.2e-103 PF13604: AAA_30" amino acids 136 to 287 (152 residues), 31.7 bits, see alignment E=1.9e-11 PF13245: AAA_19" amino acids 139 to 287 (149 residues), 26.1 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to PHOL_ECO57: PhoH-like protein (ybeZ) from Escherichia coli O157:H7

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 100% identity to eoi:ECO111_0690)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>HEPCGN_01000 PhoH-like protein (Escherichia coli ECOR38)
MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQLERRLGIEINRRDNHF
KLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKEARVLEQSAESVPEYGK
AVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQEIRR
ILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIEVAPLA
YMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTKSGLRHA
IEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAEQKRKAALAAERKREEQEQK