Protein Info for HEPCGN_00060 in Escherichia coli ECOR38

Name: rrrD
Annotation: lysozyme RrrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00959: Phage_lysozyme" amino acids 34 to 156 (123 residues), 155 bits, see alignment E=6.1e-50

Best Hits

Swiss-Prot: 99% identical to LYSD_ECOLI: Lysozyme RrrD (rrrD) from Escherichia coli (strain K12)

KEGG orthology group: K01185, lysozyme [EC: 3.2.1.17] (inferred from 99% identity to eco:b0555)

MetaCyc: 99% identical to DLP12 prophage; lysozyme (Escherichia coli K-12 substr. MG1655)
Lysozyme. [EC: 3.2.1.17]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.17

Use Curated BLAST to search for 3.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>HEPCGN_00060 lysozyme RrrD (Escherichia coli ECOR38)
MPPSLRKAVAAAIGGGAIAIASVLITGSSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWGQQ