Protein Info for GFF998 in Variovorax sp. SCN45

Annotation: Outer membrane beta-barrel assembly protein BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 17 to 377 (361 residues), 325.1 bits, see alignment E=2.4e-101 PF13570: PQQ_3" amino acids 50 to 87 (38 residues), 21.2 bits, see alignment 4.9e-08 amino acids 127 to 164 (38 residues), 28.5 bits, see alignment 2.3e-10 PF13360: PQQ_2" amino acids 78 to 305 (228 residues), 223.9 bits, see alignment E=3.5e-70

Best Hits

Swiss-Prot: 41% identical to BAMB_BURPS: Outer membrane protein assembly factor BamB (bamB) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_3700)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>GFF998 Outer membrane beta-barrel assembly protein BamB (Variovorax sp. SCN45)
MNFKRLMPESTALRAGSALVLVAFLAACSGTSKPKPEELPANPALMGVRQAWKVQVPEVK
FPLTAAINGDIVTVAGSDGTVVAIDARAGRETWRASAGTPLAAGVGSDGSLAAVVTTGNE
LVALENGKVLWKQKLSAQAFTAPLVAGRRVFVQTADRSVSAWDGQSGRRLWIQQRAGENL
VLRKSGVLIAVGDTLVAGLGGRLVGINPGNGTSRWEAPIAAPRGTNDVERLVDLTGSVSR
VGDSVCARAYYASVGCVDTARGTLAWSKPASGADGVSGDDRFVYGTESDGSVIAWRRGDG
ERAWQMSRLKNRELTSPLAVGRSLIIGESTGTLHFVSREDGALLNRVTPDGSAITVAPVL
VGNTVVVVTAKGGVFGYRPE