Protein Info for GFF993 in Variovorax sp. SCN45

Annotation: Type IV pilus biogenesis protein PilF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 23 to 269 (247 residues), 208.9 bits, see alignment E=4.1e-66 PF13432: TPR_16" amino acids 72 to 134 (63 residues), 32.8 bits, see alignment E=4.8e-11 amino acids 142 to 204 (63 residues), 17.4 bits, see alignment E=3.3e-06 PF13414: TPR_11" amino acids 76 to 113 (38 residues), 30.5 bits, see alignment 1.4e-10 PF13431: TPR_17" amino acids 90 to 120 (31 residues), 23.5 bits, see alignment 2.8e-08 amino acids 123 to 153 (31 residues), 24 bits, see alignment 1.9e-08 PF13181: TPR_8" amino acids 101 to 132 (32 residues), 21.9 bits, see alignment 8.6e-08 PF13424: TPR_12" amino acids 102 to 163 (62 residues), 31.3 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 88% identity to vap:Vapar_2185)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF993 Type IV pilus biogenesis protein PilF (Variovorax sp. SCN45)
MSMAFPMTTASAQRMLAASFAGVAVTFLLAGCVSTRTTTTSLADTSSGKGVDIVTESDES
SRQRRARLRMELASGYFEQGQTNVALDEIKQALAADPNNSDAYNLRGLVYMRLDDAGMAE
DSFRRAIAINPRDPNTRHNYGWLLCQQNRYGDAATQFNEALAVPSYADRAKTLMTRGVCE
LKAGQRAQAERTLQQAYEIDASNPVVGFNLALVLAQREEWSRAQFYIRRVNNSPSASAET
LWLGIKIERKLNNREALAQLGGQLQRRFPQSREASAYERGNFND