Protein Info for GFF992 in Variovorax sp. SCN45

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase @ tRNA (adenine(37)-C(2))-methyltransferase (EC 2.1.1.192)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 3 to 354 (352 residues), 438.1 bits, see alignment E=1.1e-135 PF21016: RlmN_N" amino acids 5 to 63 (59 residues), 87.7 bits, see alignment E=3.5e-29 PF04055: Radical_SAM" amino acids 107 to 279 (173 residues), 51.9 bits, see alignment E=1.1e-17

Best Hits

Swiss-Prot: 83% identical to RLMN_ACIAC: Dual-specificity RNA methyltransferase RlmN (rlmN) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 96% identity to vap:Vapar_2184)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF992 23S rRNA (adenine(2503)-C(2))-methyltransferase @ tRNA (adenine(37)-C(2))-methyltransferase (EC 2.1.1.192) (Variovorax sp. SCN45)
MTTANLLEFDLEGLAAFCEKLGEKKFRATQLFRWIHQRGASDFTQMTDLAKSLREKLATT
ARVEALPVLTQHESKDGTIKWLFDVGDGNAVEAVFIPEDDRGTLCVSSQAGCAVGCRFCS
TGHQGFSRNLTTGEIVAQLWFAEHFLRKHLKRDERVISNVVMMGMGEPLQNYSALVPALR
TMLDDNAYGLSRRRVTVSTSGVVPMIDRLGTDCAVAMAVSLHAPNDALRDDLVPLNRKYP
IAELLEACKRYLAHAPRDFITFEYCMLDGVNDQPEHARQLIELVRTSGVSCKFNLIPFNP
FPASGLLRSPQPRVLAFAKMLSEAGLVTTVRKTRGDDIDAACGQLAGDVKDRTRAAERMA
QRRAAERPIVLHPVRKTLPQEH