Protein Info for GFF986 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methylglutaconyl-CoA hydratase (EC 4.2.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 16 to 264 (249 residues), 175 bits, E=1.8e-55
• PF16113: ECH_2
  • amino acids 19 to 213 (195 residues), 107.8 bits, E=8.3e-35

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 97% identity to pol:Bpro_5267)

MetaCyc: 41% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• phenylacetate degradation I (aerobic) (8/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• benzoyl-CoA degradation I (aerobic) (6/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• L-leucine degradation I (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• ferrichrome A biosynthesis (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17, 4.2.1.18

Use Curated BLAST to search for 4.2.1.17 or 4.2.1.18

Protein Sequence (265 amino acids)

>GFF986 Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTPTYETLQLVVDARGVARLTLNRPDTHNALNATLISELRRAVDWLAVAPGVRAVVLTG
TGKTFCAGGDLGWMQDNMKKSRTERVGESGDLALMLRALNELPMPVIGRINGPAYGGGVG
MISVCDITIAVDTGIYSLTEVRLGLLPANIAPYVVARMGEANARRTFLTARRMSAAEAQR
LGLLSEVVAADQLDAAIERELADLLQCAPGAVAATKKLVAYVQAHDLPTNMIYTADKLAD
AWETEEGRDGIAAFFGKRLPVWRQV