Protein Info for PS417_04990 in Pseudomonas simiae WCS417

Annotation: GIY-YIG nuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF01541: GIY-YIG" amino acids 10 to 80 (71 residues), 53.7 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 52% identical to Y3539_VIBCH: UPF0213 protein VC_A0739 (VC_A0739) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07461, putative endonuclease (inferred from 97% identity to pfs:PFLU1020)

MetaCyc: 43% identical to DNA damage response nuclease YhbQ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"FIG00955494: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U550 at UniProt or InterPro

Protein Sequence (91 amino acids)

>PS417_04990 GIY-YIG nuclease (Pseudomonas simiae WCS417)
MTDPSAPKPWFVYLVRAANGSLYCGISNDPVRRFASHQSGKGARFFLSSPAVALVYTEQC
ASKGEALRQERLIKKLKKSAKECLAASGSLI