Protein Info for GFF984 in Methylophilus sp. DMC18

Annotation: Peptide chain release factor RF2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00020: peptide chain release factor 2" amino acids 2 to 302 (301 residues), 471.7 bits, see alignment E=7.1e-146 PF03462: PCRF" amino acids 2 to 159 (158 residues), 162.4 bits, see alignment E=1.2e-51 PF00472: RF-1" amino acids 168 to 276 (109 residues), 146.4 bits, see alignment E=3.4e-47

Best Hits

Swiss-Prot: 74% identical to RF2_AROAE: Peptide chain release factor 2 (prfB) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 86% identity to meh:M301_1981)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF984 Peptide chain release factor RF2 (Methylophilus sp. DMC18)
MLESVVMTLDDVSQSLSDSRELFDMAREEGDDDTLLSVEADAQKIEKIVAEMEFKRMFSQ
PMDANNCFIEFQSGSGGTEAQDWAGMLLRMYLRYVERKGFKVEVLEESEGDIAGIKGASI
KVTGDYAFGTLRTESGVHRLVRKSPFDANSKRHTSFASVQIFPEVDDSIEIEINPADLRI
DTYRASGAGGQHINKTDSAVRITHLPTGVVVQCQNDRSQHRNKEEAMNMLKGALYNLELS
KRNEEKQALEDAKTDIGWGHQIRSYVLDQGRIKDLRTNVEIGNTQGVLDGDLDPFIMESL
KQGL