Protein Info for GFF981 in Methylophilus sp. DMC18

Annotation: Protein SphX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 9 to 292 (284 residues), 320.9 bits, see alignment E=3.7e-100 PF12849: PBP_like_2" amino acids 24 to 277 (254 residues), 148 bits, see alignment E=4.6e-47 PF12727: PBP_like" amino acids 48 to 274 (227 residues), 39.7 bits, see alignment E=3e-14

Best Hits

Swiss-Prot: 52% identical to SPHX_SYNE7: Protein SphX (sphX) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 69% identity to mep:MPQ_1869)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF981 Protein SphX (Methylophilus sp. DMC18)
MKTRLFRNTMIAALVAQAFTFAHTAAAADKIIKIDGSSTVYPITEAVAEEFQRSKGVKVT
VGESGTGGGFKKFCRGETDISDASRPISQKEIDACKEGGVQFIELPIAYDALTVVVNSKN
DWVKQITVAELKKIWEPGSKVKNWKEVNATYPDKAINLYGPGTASGTFDYFTEAVNGKAK
ASRTDYTPSEDDNVLVQGVAGNVGGMAYFGMAYYQENTDKLKAVPVVAKEGAKPVLPSET
TVMDGTYQPLSRPLFIYVNATAAAFKPEVKAFVNYYLENAPLLVKEVKYVPLPKEDYEAV
KTHFKAMKPGTGFNGTAEVGIKITDLLSRIK