Protein Info for PS417_00495 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 139 to 155 (17 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 263 to 309 (47 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 134 to 377 (244 residues), 233.1 bits, see alignment E=2.2e-73 PF02405: MlaE" amino acids 166 to 375 (210 residues), 240.8 bits, see alignment E=6.1e-76

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 96% identity to pfs:PFLU0098)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TV64 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PS417_00495 ABC transporter permease (Pseudomonas simiae WCS417)
MTPPTTAGAAHLDTSTTPPQLRITGDWTLAHYANLKKLSDKLDGQYDAGARIDLNGLGAL
DTAGASLLVELLGPTRIEQSAEQTDCSLSAADRALLKTVYRSLNDFCVPDKAPEEAAGIQ
VLARIGRAVDTVWQDSKKLLGFIGLILETFARGIFRPKRWRITPMVAHIEQTGLDAAPIV
ALLTFLVGAVVAFLGATVLKSFGATIFTVDLVAFSFLREFGVLLTAILIAGRTASAFTAQ
IGSMKANEEIDAIRTLGLDPMELLVLPRVLALLVSLPMLTFLAMLSGIVGGGVVCAVALD
ISPAMFLSLLQSDIGVQHFLVGMVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVV
QSIFVVIVLDALAALFFMEMDW