Protein Info for GFF979 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uxu operon transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00392: GntR" amino acids 2 to 57 (56 residues), 74.7 bits, see alignment E=3.7e-25 PF07729: FCD" amino acids 81 to 210 (130 residues), 79.6 bits, see alignment E=2.8e-26

Best Hits

Swiss-Prot: 90% identical to UXUR_ECOLI: Uxu operon transcriptional regulator (uxuR) from Escherichia coli (strain K12)

KEGG orthology group: K13637, GntR family transcriptional regulator, uxuAB operon transcriptional repressor (inferred from 100% identity to sec:SC4362)

Predicted SEED Role

"Uxu operon transcriptional regulator" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>GFF979 Uxu operon transcriptional regulator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIRDLIVQTPYRPGERLPPEREIAERLNVTRTVVREALIMLEIKGLVEVRRGAGIYVLDS
ADNNEMEGADVNHCNDAGPFELLQARQLLESNIAEFAALQATREDIIKMRQALQLEEREL
ASSAPGGSESGDMQFHLAIAEATHNSMLVELFRQSWQWRENNPMWLQLHSHLGDTLYRKE
WLVDHKQILAALIKKDARAAKLAMWQHLENVKQRLLEFSNVDDIYFDGYLFESWPLDNVD
A