Protein Info for PS417_04945 in Pseudomonas simiae WCS417

Annotation: fimbrial chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00345: PapD_N" amino acids 31 to 148 (118 residues), 73.3 bits, see alignment E=1.8e-24 PF02753: PapD_C" amino acids 169 to 225 (57 residues), 26.5 bits, see alignment E=6.4e-10

Best Hits

Swiss-Prot: 42% identical to YHCA_ECOLI: Uncharacterized fimbrial chaperone YhcA (yhcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 70% identity to pfs:PFLU1011)

Predicted SEED Role

"Beta-fimbriae chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWC3 at UniProt or InterPro

Protein Sequence (240 amino acids)

>PS417_04945 fimbrial chaperone protein (Pseudomonas simiae WCS417)
MNLFLSVWRAMPRLCCVALAVFGATVARADGMVPDTSVVIVNEAHGEATVSVTNTDNKMA
LLHVTLENIPEDSDTLLFVTPPLTRVEASKSQLVRFILQTQAPLQTQRLKRAIFEGMPAQ
RDPAQAGRAQVGVTVRQNLPVIIHPKGLAPNRTPWLGLSWTLKADQLSVHNPTPYVVRLA
QELQLLPGNASAMLPRTYVLPGETLTMTASGTGTGTTRVRLQPATVYGFAVEPHDAPITL