Protein Info for GFF975 in Methylophilus sp. DMC18

Annotation: D-inositol-3-phosphate glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF20706: GT4-conflict" amino acids 4 to 332 (329 residues), 45.8 bits, see alignment E=1.3e-15 PF13439: Glyco_transf_4" amino acids 14 to 190 (177 residues), 118.8 bits, see alignment E=8.1e-38 PF13579: Glyco_trans_4_4" amino acids 15 to 185 (171 residues), 65.8 bits, see alignment E=1.8e-21 PF00534: Glycos_transf_1" amino acids 199 to 364 (166 residues), 131.7 bits, see alignment E=6.2e-42 PF13692: Glyco_trans_1_4" amino acids 209 to 350 (142 residues), 108.6 bits, see alignment E=9.8e-35 PF13524: Glyco_trans_1_2" amino acids 267 to 380 (114 residues), 30.6 bits, see alignment E=9.1e-11

Best Hits

KEGG orthology group: None (inferred from 59% identity to meh:M301_0256)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>GFF975 D-inositol-3-phosphate glycosyltransferase (Methylophilus sp. DMC18)
MKILMISDVYFPRVNGVSTSIRTFAQSLRQQGHVVHLIAPKYPVAIEQSQTEDEQWITRI
DARKIVFDPEDYLMKWSALMDYAGHLHTGDYDLVHIHTPFIAHYAGLKIAKQLQVPAVET
YHTFFEDYMHHYLPWVPRSLAVRIAQSVSRKQCQQVDTVVSPSAQMRDVLQQYGVTTPIT
VIPTGLDASRFIPGDGAAFREKYGIPAQRPLLLFVGRVAHEKNIQFLLEMLSLVIQDHPE
VLLVITGEGPAEAMLKKMSRDKGLQQHVMFLGYLDRAIGLNAAYQAADIFVFASKSETQG
LVLLEAMAQATPVVAIAELGTASILRQEQGALIAKDDELHFAEQVQTLLIDRQLRERIGK
QGKRYVEQVWSSDAQATKLIECYQRLVLSHLSLAASATA