Protein Info for GFF971 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 PF05401: NodS" amino acids 56 to 167 (112 residues), 25.8 bits, see alignment E=6.7e-09 PF07021: MetW" amino acids 57 to 136 (80 residues), 25.4 bits, see alignment E=7.5e-09 PF13489: Methyltransf_23" amino acids 62 to 190 (129 residues), 55.4 bits, see alignment E=4.8e-18 amino acids 321 to 475 (155 residues), 36.7 bits, see alignment E=2.8e-12 PF13847: Methyltransf_31" amino acids 66 to 171 (106 residues), 50.6 bits, see alignment E=1.4e-16 amino acids 328 to 435 (108 residues), 42.4 bits, see alignment E=4.6e-14 PF03848: TehB" amino acids 66 to 163 (98 residues), 29.1 bits, see alignment E=4.9e-10 PF05175: MTS" amino acids 66 to 172 (107 residues), 37.8 bits, see alignment E=1.1e-12 PF13649: Methyltransf_25" amino acids 69 to 163 (95 residues), 78.2 bits, see alignment E=4.9e-25 amino acids 333 to 427 (95 residues), 44.3 bits, see alignment E=1.8e-14 PF08242: Methyltransf_12" amino acids 70 to 165 (96 residues), 48.2 bits, see alignment E=1.2e-15 amino acids 334 to 429 (96 residues), 32.3 bits, see alignment E=1e-10 PF08241: Methyltransf_11" amino acids 70 to 166 (97 residues), 61.8 bits, see alignment E=5.9e-20 amino acids 334 to 431 (98 residues), 38.8 bits, see alignment E=8.9e-13 PF02353: CMAS" amino acids 316 to 405 (90 residues), 32.6 bits, see alignment E=4.1e-11 PF01135: PCMT" amino acids 319 to 431 (113 residues), 29 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM4500)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>GFF971 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWIT
RQLPAGARILDLGCGPGFYTRLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQD
IRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQWLKPDGKLLVEVHTFDEVKRQGM
AQPGWQRCPHGLFLAEPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRDDE
YISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLVEKVSTSEGIALSKRNNPMDIPRIF
TISESEHRIHNPFTAEKYATLGHALRMKPGMRILDLGSGSGEMLCTWARDYGVTGTGIDI
SPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYDVAACVGATWIAGGVAGTIDLLA
KSLKPGGIILIGEPYWRRIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMVLA
DPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIA
R