Protein Info for GFF971 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05401: NodS
  • amino acids 56 to 167 (112 residues), 25.8 bits, E=6.7e-09
• PF07021: MetW
  • amino acids 57 to 136 (80 residues), 25.4 bits, E=7.5e-09
• PF13489: Methyltransf_23
  • amino acids 59 to 193 (135 residues), 56.1 bits, E=2.9e-18
  • amino acids 319 to 475 (157 residues), 36.9 bits, E=2.4e-12
• PF05175: MTS
  • amino acids 66 to 172 (107 residues), 36.7 bits, E=2.6e-12
• PF13847: Methyltransf_31
  • amino acids 66 to 171 (106 residues), 49.6 bits, E=2.7e-16
  • amino acids 328 to 435 (108 residues), 44.3 bits, E=1.1e-14
• PF03848: TehB
  • amino acids 66 to 163 (98 residues), 29.1 bits, E=4.9e-10
• PF13649: Methyltransf_25
  • amino acids 69 to 163 (95 residues), 78.3 bits, E=4.4e-25
  • amino acids 333 to 427 (95 residues), 44.1 bits, E=2e-14
• PF08242: Methyltransf_12
  • amino acids 70 to 165 (96 residues), 48.2 bits, E=1.2e-15
  • amino acids 334 to 429 (96 residues), 32.3 bits, E=1e-10
• PF08241: Methyltransf_11
  • amino acids 70 to 166 (97 residues), 61.8 bits, E=5.9e-20
  • amino acids 334 to 431 (98 residues), 38.8 bits, E=8.9e-13
• PF02353: CMAS
  • amino acids 316 to 405 (90 residues), 32.6 bits, E=4.1e-11
• PF01135: PCMT
  • amino acids 319 to 431 (113 residues), 29 bits, E=6.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM4500)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Protein Sequence (541 amino acids)

>GFF971 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDISAVIFATHRIRLLPDEGKIPWDEPAFSQRMLENHLSQDHDWASRRLTVIEQQVTWIT
RQLPAGARILDLGCGPGFYTRLLAERGFHCTGVDFSPASITWARQQAQAANLNIDYIQQD
IRTYHPTEPFDFIMMTFGELNVFSAADAQSLISHCAQWLKPDGKLLVEVHTFDEVKRQGM
AQPGWQRCPHGLFLAEPHLLLTENAWDEEAQTSSTQFWAIAENGCTTRFGSQMKAWRDDE
YISLLGDAGFTVLQRPDSHTWPVGETFAGKLFALLVEKVSTSEGIALSKRNNPMDIPRIF
TISESEHRIHNPFTAEKYATLGHALRMKPGMRILDLGSGSGEMLCTWARDYGVTGTGIDI
SPLFTTQAKQRAEELGVSEYVHFIHNDAAGYIDEEKYDVAACVGATWIAGGVAGTIDLLA
KSLKPGGIILIGEPYWRRIPATEEIAHACGVSSVADFRPLPELVAFFDQLGYDVVEMVLA
DPQGWDRYEAAKWMTMRRWLEENPDDEFAQEVRTELTVAPKRHVTWTREYFGWGVFALIA
R