Protein Info for GFF962 in Sphingobium sp. HT1-2

Annotation: 2-polyprenyl-6-methoxyphenol hydroxylase; 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01494: FAD_binding_3" amino acids 4 to 334 (331 residues), 108.6 bits, see alignment E=2e-35 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 5 to 387 (383 residues), 390 bits, see alignment E=5.4e-121

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 90% identity to sjp:SJA_C1-33860)

MetaCyc: 45% identical to 2-methoxy-6-(all-trans-nonaprenyl)phenol 4-hydroxylase (Rhodospirillum rubrum)
1.14.13.M56 [EC: 1.14.13.M56]; RXN-9239 [EC: 1.14.13.M56, 1.14.13.240]

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-); 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.240 or 1.14.13.M56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF962 2-polyprenyl-6-methoxyphenol hydroxylase; 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (Sphingobium sp. HT1-2)
MQRFDVVILGGGLVGLTLGIALSRHGVQCAVIDPADPVQATAAGFDGRVSAISSTSFAML
QAIGVGAHLEGKGCPIDRIWVSDGLEPGALDFVPDADDGVMGTMFPNRDLRIALAQTAAE
AENLTIFQPDRAVHVDRNADGVTLTLQNGATIAGALLVAAEGRNSPTREAAGINTTRWQY
KHTAMVTAIDHEVPHANTAYEIFYVGGPLALLPMLPGTRSAVVWTVPTDQAPAMLKLSER
AWLAEMQKRIGGFLGEISLAGPRSSYPLGFHHAARITDTRLALVGDSAHAIHPIAGQGLN
LGFRDVAALVEVLVEGMRLGLDPGDAQLLARYQRWRGLDTMMTSVAMDGLVRLFDIPGKL
PSLVRRAGLAAVQRTSLLKNRFMAEARGQSGALPRLLAGEMV