Protein Info for GFF960 in Xanthobacter sp. DMC5

Annotation: Glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00749: tRNA-synt_1c" amino acids 3 to 306 (304 residues), 323.5 bits, see alignment E=1.1e-100 TIGR00464: glutamate--tRNA ligase" amino acids 4 to 470 (467 residues), 513.9 bits, see alignment E=2.2e-158 PF19269: Anticodon_2" amino acids 329 to 468 (140 residues), 119.1 bits, see alignment E=2e-38

Best Hits

Swiss-Prot: 91% identical to SYE1_XANP2: Glutamate--tRNA ligase 1 (gltX1) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 91% identity to xau:Xaut_4369)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.17

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF960 Glutamate--tRNA ligase (Xanthobacter sp. DMC5)
MSQIVTRFAPSPTGFLHIGGARTALFNWLYARHTGGKMLLRIEDTDRQRSTKEAIDAILE
GLSWLGIDWDGDPIYQFARAERHQAAVAEMLAKGNAYRCYATPQELDEMRELARKEGRPP
RYDGRWRDRDPSEAPADRAPVIRLRAPQEGETVIDDMVQGTVTFPNKDLDDLVLLRSDGT
PTYMLAVVVDDHDMGVTHIIRGDDHLTNAARQTQIYRALGWDVPRMAHIPLIHGPDGAKL
SKRHGALGVDAYRDMGYLPAALRNYLVRLGWSHGDQEVFSTDEMVEFFDLDKVGRSAARF
DFAKLESLNGHYMRASSDADLLAAIDALVPYLPDAEHRLPRMTDTRRAQLAAAMPGLKER
AKTLVELLDNAEFIFVERPIPLDEKATTLLSAEGRAHLGRLVPLLEAVEWTAAATEEVVR
RYAEAQSVKLGAVAQPLRAALTGKSTSPPVFDVLIVLGREESLGRLRDQAI