Protein Info for GFF960 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative ATP-dependent protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 transmembrane" amino acids 599 to 614 (16 residues), see Phobius details TIGR02653: conserved hypothetical protein" amino acids 22 to 694 (673 residues), 1343.1 bits, see alignment E=0 TIGR02688: TIGR02688 family protein" amino acids 28 to 475 (448 residues), 615.1 bits, see alignment E=6.8e-189 PF20442: BrxL_N" amino acids 30 to 161 (132 residues), 185 bits, see alignment E=8.8e-59 PF13337: BrxL_ATPase" amino acids 172 to 484 (313 residues), 495.3 bits, see alignment E=8.2e-153 PF05362: Lon_C" amino acids 515 to 689 (175 residues), 50 bits, see alignment E=4.3e-17

Best Hits

KEGG orthology group: K01338, ATP-dependent Lon protease [EC: 3.4.21.53] (inferred from 100% identity to stm:STM4491)

Predicted SEED Role

"putative ATP-dependent protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.53

Use Curated BLAST to search for 3.4.21.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>GFF960 putative ATP-dependent protease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQTHHDLPVPAVSEGELVAEGYDLDALLNQHFRGRVVRKDLTKQLKEGANVPVYVLEYLL
GMYCASDDDQIVEQGLQNVKRILADNYVRPDEAEKVKSLIRERGSYKIIDKVSVKLNQKK
DVYEAQLSNLGIKDALVPPQMVKDNEKLLTGGIWCMITVNYFFEEGQKTSPFSLMTLKPI
QMPNMDMEEVFTARTHFNRDQWIDVLLRSVGMEPANIEQRTKWHLITRMIPFVENNYNVC
ELGPRGTGKSHVYKECSPNSLLVSGGQTTVANLFYNMASRQIGLVGMWDVVAFDEVAGIT
FKDKDGVQIMKDYMASGSFSRGRDSIEGKASMVFVGNINQSVETLVKTSHLLAPFPAAMI
DTAFFDRFHAYIPGWEIPKMRPEFFTNRYGLITDYLAEYMREMRKRSFSDAIDKFYKLGN
NLNQRDVIAVRRTVSGLLKLLHPNGSYSKEDVRVCLTYAMEARRRVKEQLKKLGGLEFFD
VNFSYIDNETLEEFFVSVPEQGGSELIPAGMPKPGVVHLVTQAESGMTGLYRFETQMTAG
NGKHSVSGLGSSTSAKEAIRVGFDYFKGNLSRVSATAKFSEHEYHLHVVELHNTGPSTAT
SLAALIALCSVLLAKPVQEQMVVLGSMTLGGVINPVQDLAASLQLAFDSGAKKVLLPMSS
AVDIPTVPAELFTKFQVSFYSEPVDAVYKALGVN