Protein Info for GFF96 in Pseudomonas sp. DMC3

Annotation: Transcriptional regulatory protein CreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 88.9 bits, see alignment E=2.5e-29 PF00486: Trans_reg_C" amino acids 145 to 220 (76 residues), 75.1 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 48% identical to BAER_ECOLI: Transcriptional regulatory protein BaeR (baeR) from Escherichia coli (strain K12)

KEGG orthology group: K07663, two-component system, OmpR family, catabolic regulation response regulator CreB (inferred from 94% identity to pfo:Pfl01_5196)

Predicted SEED Role

"Two-component response regulator CreB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF96 Transcriptional regulatory protein CreB (Pseudomonas sp. DMC3)
MPHILIVEDEAAIADTLIFALQGEGFSTTWLNLGAAALEHQRQTPADLIILDIGLPDISG
FETCKQLRRFTEVPVLFLSARDAEIDRVVGLEIGADDYVVKPFSPREVAARVKAILKRMA
PRATLEAGSTLFRIDAERVQISYRGQPLSLTRHEFRLLQCLLEQPERVFSREQLLDALGV
AADAGYERSIDSHIKSLRAKLRLVRAEAEPIQTHRGLGYSYSPGHS