Protein Info for PS417_04865 in Pseudomonas simiae WCS417

Annotation: molybdenum cofactor biosynthesis protein MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 2 to 149 (148 residues), 228.8 bits, see alignment E=1.1e-72 PF01967: MoaC" amino acids 13 to 147 (135 residues), 195.2 bits, see alignment E=2.3e-62

Best Hits

Swiss-Prot: 98% identical to MOAC_PSEFS: Cyclic pyranopterin monophosphate synthase (moaC) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 98% identity to pfs:PFLU0995)

MetaCyc: 66% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGC7 at UniProt or InterPro

Protein Sequence (157 amino acids)

>PS417_04865 molybdenum cofactor biosynthesis protein MoaC (Pseudomonas simiae WCS417)
MLTHLDSQGRAHMVDVTDKSVTFREAVAEARVRMLPETLQMIVDGAHPKGDVFAVARIAG
IQAAKKTSDLIPLCHPLMLTGVKVELSAEGADSVHIVARCKLSGQTGVEMEALTAASVAA
LTLYDMCKAVDRGMTIENIRLLEKLGGKSGHFKADQA