Protein Info for GFF958 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Naphthoate synthase (EC 4.1.3.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR03210: 2-ketocyclohexanecarboxyl-CoA hydrolase" amino acids 3 to 257 (255 residues), 467.6 bits, see alignment E=4.5e-145 PF00378: ECH_1" amino acids 12 to 257 (246 residues), 245 bits, see alignment E=7.7e-77 PF16113: ECH_2" amino acids 15 to 209 (195 residues), 81.4 bits, see alignment E=9.4e-27

Best Hits

Swiss-Prot: 54% identical to MENB_STAHJ: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: K07536, 2-ketocyclohexanecarboxyl-CoA hydrolase [EC: 3.1.2.-] (inferred from 73% identity to reu:Reut_B3916)

MetaCyc: 70% identical to BadI (Rhodopseudomonas palustris)
3.7.1.-

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-, 4.1.3.36

Use Curated BLAST to search for 3.1.2.- or 4.1.3.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF958 Naphthoate synthase (EC 4.1.3.36) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEFKDILYEELDSVAYIAINRPEVMNAFRGQTVEELLQAFMKAGWDKRIAAIVLTGTGDR
AFCTGGDQSAHAGQYDGRGTIGIPVEEFHSAIRDVPKPVIARVQGYAIGGGNVLATLCDM
TIASEKAVFGQVGPKVGSVDPGWGTAYLSHVVGEKKAREIWYMCRRYSAQEALAMGLCNT
VVPHDQLDAEVARWCKEIVEKSPTALAIAKRSFNASTEHIRGIGSLGLQALSLYYDTAES
KEGVSAFLEKRRPDFRQWANGRK