Protein Info for GFF957 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868
Annotation: Alcohol dehydrogenase (EC 1.1.1.1)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to AHR_ECOLI: Aldehyde reductase Ahr (ahr) from Escherichia coli (strain K12)
KEGG orthology group: K12957, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 99% identity to seg:SG4310)MetaCyc: 92% identical to NADPH-dependent aldehyde reductase Ahr (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.2]
Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- mixed acid fermentation (16/16 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
- heterolactic fermentation (15/18 steps found)
- (S)-propane-1,2-diol degradation (5/5 steps found)
- ethanolamine utilization (5/5 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- pyruvate fermentation to ethanol I (3/3 steps found)
- pyruvate fermentation to ethanol III (3/3 steps found)
- ethanol degradation I (2/2 steps found)
- pyruvate fermentation to ethanol II (2/2 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-methionine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- glycerol degradation to butanol (11/16 steps found)
- D-xylose degradation to ethylene glycol (engineered) (2/4 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- pyruvate fermentation to butanol I (4/8 steps found)
- L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- salidroside biosynthesis (1/4 steps found)
- serotonin degradation (3/7 steps found)
- phenylethanol biosynthesis (1/5 steps found)
- butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Alkaloid biosynthesis I
- Caprolactam degradation
- Carotenoid biosynthesis - General
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycerolipid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Insect hormone biosynthesis
- Metabolism of xenobiotics by cytochrome P450
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Retinol metabolism
- Trinitrotoluene degradation
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1
Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (339 amino acids)
>GFF957 Alcohol dehydrogenase (EC 1.1.1.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868) MTIIKSYAAKEAGGELELYEYDAGELQPEDVEVRVDYCGICHSDLSMIDNEWGFSQYPLV AGHEVIGRVAALGSAAQDKGLKVGQRVGIGWTARSCGHCDACISGNQINCQEGAVPTILN RGGFAEKLRAGWQWVIPLPENIDMASAGPLLCGGITVFKPLLMHHITATSRVGVIGIGGL GHIAIKLLHAMGCEVTAFSSNPSKEQEVLAMGANNVVNSRDPEALKALAGQFDLIINTVN VDLDWQPYFEALTYGGNFHTVGAVLKPLPVPAFTLIAGDRSISGSATGTPYELRKLMKFA GRSKVAPTTELFAMSQINEAIQHVRDGKARYRVVLKADF