Protein Info for GFF951 in Variovorax sp. SCN45

Annotation: Chaperone protein HscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 TIGR01991: Fe-S protein assembly chaperone HscA" amino acids 21 to 619 (599 residues), 885.6 bits, see alignment E=8.1e-271 PF00012: HSP70" amino acids 21 to 604 (584 residues), 590.1 bits, see alignment E=4.4e-181 PF06723: MreB_Mbl" amino acids 153 to 380 (228 residues), 61.5 bits, see alignment E=6.4e-21

Best Hits

Swiss-Prot: 90% identical to HSCA_VARPS: Chaperone protein HscA homolog (hscA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K04044, molecular chaperone HscA (inferred from 90% identity to vap:Vapar_2146)

Predicted SEED Role

"Chaperone protein HscA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>GFF951 Chaperone protein HscA (Variovorax sp. SCN45)
MALLQISEPGQAPDPHQRRIAVGIDLGTTHSLVASVRNGVAECLPDDQGRVLLPSAVRYL
EGDRRQIGFDAVAARAQDPANTITSVKRLMGRGLADIANRDAMSYSIGSSDGGMVNVQTL
AGEKSPVEISAEILATLRYRAQDTFDDDELYGAVITVPAYFDEGQRQATKDAAQLAGLNV
LRLISEPTAAAIAYGLDNASEGVYAVYDLGGGTFDISILRLTQGVFEVIATGGDSALGGD
DYDHALADFVLAQTGLQAGSDADKAALLVAARAAKEALTDSASTTFSANVAGTVANFDLS
REQFYTATQPLTDRTIAAVRKALRDAKLKPDELQGIVLVGGSTRMPQVRRAVADFFGREP
LVNLNPDEVVALGAAIQANQLAGNNGAGELLLLDVIPLSLGIETMGGLVERIVPRNQTIP
TAMAQDFTTYQDGQTALALHVVQGERDLVSDCRSLARFTLRGIPPMAAGAARIRVTFTVD
ADGLLSVSAKEQGSGVEASVAVKPSYGLSDDQIATMLQESFSTAQQDMQARALVEARVDA
DRMLLATQSALDADGDLLSDEERTLIDASMAQLREAAKTSNDAGAIEAATKKLADDTEAF
AAQRMNAGIARALAGRKVESL