Protein Info for GFF950 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG000988: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 1 to 317 (317 residues), 348.7 bits, see alignment E=1.4e-108 PF03739: LptF_LptG" amino acids 2 to 313 (312 residues), 228.5 bits, see alignment E=6.2e-72

Best Hits

Swiss-Prot: 95% identical to LPTF_SHIFL: Lipopolysaccharide export system permease protein LptF (lptF) from Shigella flexneri

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 99% identity to ses:SARI_03165)

MetaCyc: 100% identical to lipopolysaccharide ABC transporter permease (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"FIG000988: Predicted permease"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>GFF950 FIG000988: Predicted permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VRILGAAVDGDIPANLVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHAC
GLSKAVLVKAAMVLALFTGILAAVNVMWAGPWSSKHQDEVLAEAKANPGMAALAQGQFQQ
ATNGNSVLFIESVDGSDFHDVFLAQIRPKGNARPSVVVADSGHLTQLRDGSQVVTLNKGT
RFEGTALLRDFRITDFQNYQAIIGHQAVALDPNDTDQMDMRTLWNTDNDRARAELHWRIT
LVFTVFMMALMVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSIKSNGGKGKLDPVIWM
WAVNLIYLALAIGLNLWDTVPVRRLRARFLRKGAV