Protein Info for GFF95 in Pseudomonas sp. DMC3

Annotation: Sensor protein CreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details PF00672: HAMP" amino acids 201 to 251 (51 residues), 35.1 bits, see alignment 2e-12 PF00512: HisKA" amino acids 259 to 319 (61 residues), 51.7 bits, see alignment E=1.1e-17 PF02518: HATPase_c" amino acids 368 to 472 (105 residues), 51.7 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: K07641, two-component system, OmpR family, sensor histidine kinase CreC [EC: 2.7.13.3] (inferred from 88% identity to pfo:Pfl01_5195)

Predicted SEED Role

"Two-component response regulator CreC"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>GFF95 Sensor protein CreC (Pseudomonas sp. DMC3)
MSLGLRIFLVYVLFVGLTGYFVLNTVMEEIRPGVRQSTEETLVDTANLMAEILRDDFKAG
TLSENRWPQLLRAYGERQPQATIWGLPKNQVNHRIYVTDAKGIVVLDSSGVAVGQDYSRW
NDVYLTLRGEYGARSSRSDPDDPSSSVMHVGAPIRDNGKIIGVVTVAKPNSSLQPYVDRT
ERRLLFYGAGLIGLGLLFGALLSWWLSRALHRLTGYAQAVSEGRRVEVPHYRGGELEQLA
TAVEQMRTQLEGKAYVERYVHTLTHELKSPLAAIRGAAELLQSDMPAVQRLRFVSNIDSE
SARMQQLIERLLNLAQVEQRQGLEERVAVPLALLVAELLKAQAARIEGKQLRVEQAIGED
LLLIGEPFLLRQALGNLLENALDFTPTSGLLRLSAERVGEQIEFRLFNQTTPIPDYALPR
LTERFYSLPRPDSGRKSTGLGLNFVEEVVKLHDGVMRIGNVEGGVEVVLRLP