Protein Info for GFF949 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 323 (279 residues), 143 bits, see alignment E=5.3e-46

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 40% identity to pgv:SL003B_2520)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF949 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRSGNFKQNYRQLLALTDSVPVIVWSCLLVALLAAAPLLLAKYYVSVILLLLITAVGVLG
LNLLTGTTGLISLGHSGFLAVGAYTAGIVASKLGWPMLASIFAGGVSAAIAGIIVGIPSL
RLKGLYLAITTMAFAVIINHLILNGGDLTGGSEGLTVPQPSLFGQALGAERGYYYVVLCF
VVVFTFITLNILRSRIGRAFQAIREHDIAAKAMGVNLVRYKLLAFMVSAFYTGIAGGLLA
YYTRYLNVDSFSLLISIEALSMLIVGGLGSVAGALLGTAFIVLLNESLGFVFGMIGASFG
GSGSTAAYEIKGVIYGLAIVLFLRFEPDGLMGRWRDIKHYWTHWPFRF