Protein Info for GFF946 in Variovorax sp. SCN45

Annotation: Iron-sulfur cluster regulator IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 147.4 bits, see alignment E=2.2e-47 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 211.8 bits, see alignment E=2.8e-67 PF02082: Rrf2" amino acids 3 to 133 (131 residues), 140.3 bits, see alignment E=2.2e-45

Best Hits

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 100% identity to vpe:Varpa_3750)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>GFF946 Iron-sulfur cluster regulator IscR (Variovorax sp. SCN45)
MRLTTKGRFAVTAMIDLALRQNTGPVTLAAISQRQQISLSYLEQLFGKLRRHELVESTRG
PGGGYSLGRKAADITVADIIVSVDEPIDATQCGGKENCLGEAGRCMTHELWASLNQRMVE
FLDSVTLQKLVDDQIAKGVQIENKPVVKRAISAQPVVKPIRVNAPNSVFALGNAFAKS