Protein Info for GFF945 in Variovorax sp. SCN45

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 TIGR00631: excinuclease ABC subunit B" amino acids 33 to 687 (655 residues), 1045.7 bits, see alignment E=0 PF04851: ResIII" amino acids 44 to 147 (104 residues), 38.2 bits, see alignment E=5e-13 PF17757: UvrB_inter" amino acids 190 to 277 (88 residues), 108.6 bits, see alignment E=5e-35 PF27431: UvrB_3rd" amino acids 283 to 343 (61 residues), 92.7 bits, see alignment 3.8e-30 PF00271: Helicase_C" amino acids 463 to 572 (110 residues), 72.3 bits, see alignment E=1.3e-23 PF12344: UvrB" amino acids 579 to 621 (43 residues), 77 bits, see alignment 2.6e-25 PF02151: UVR" amino acids 656 to 690 (35 residues), 35.5 bits, see alignment (E = 2.2e-12)

Best Hits

Swiss-Prot: 77% identical to UVRB_BURMA: UvrABC system protein B (uvrB) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 94% identity to vap:Vapar_2140)

MetaCyc: 68% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (702 amino acids)

>GFF945 Excinuclease ABC subunit B (Variovorax sp. SCN45)
MPDNNEAIADLKKLDPIGPAKQGEFIRYPDSPFELFQPYPPAGDQPKAIEGLVEGVIDGE
VFQTLLGVTGSGKTYTMANVIARLGRPAIVFAPNKTLAAQLYSEFREFFPKNAVEYFVSY
YDYYQPEAYVPQRDLFIEKDSSINEHIEQMRLSATKSVLERRDTVIVATVSAIYGIGTPE
DYMEMRLIARVGDKVGQRDLISRLIRMQYLRNEQDFARGTFRVRGDTIDVFPAEHSELAI
RFELFDDEIESLQLFDPLTGRIRQKVPRFTVYPSSHYVTPRDKVMAAVETIKIELAGRLK
ELVGAGKLVEAQRLEQRTRFDLEMLAEIGHCKGIENYTRHLSGAAPGDPPATLTDYLPKD
ALMFLDESHQMVGQLSAMYNGDRARKTTLVEYGFRLPSALDNRPLKMEEFEARVRQCIFV
SATPAQYEKDHAGNVVEQLVRPTGLIDPEVEVRPATHQVDDVLGEIRVRVEKNERVLITT
LTKRMSEQLTDYLGDNGVKVRYLHSDVDTVERVEILRDLRLGTFDVLVGINLLREGLDIP
EVSLVAILDADKEGFLRAERSLIQTIGRAARNLNGKAILYADRMTDSMKKAIDETERRRA
RQIAHNEANGITPRSIVKQVRDLIDGVYSEKTGKEMAKLDLERAKVEDMSEKDIAREIKR
LEKQMLEHARNLEFEKAARVRDQLALLREQAFGAAGGDNIAL