Protein Info for GFF944 in Methylophilus sp. DMC18

Annotation: NADH-quinone oxidoreductase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01958: NADH-quinone oxidoreductase, E subunit
  • amino acids 9 to 156 (148 residues), 194.2 bits, E=6.5e-62
• PF01257: 2Fe-2S_thioredx
  • amino acids 13 to 156 (144 residues), 168.9 bits, E=3.2e-54

Best Hits

Swiss-Prot: 44% identical to NUOE_RICBR: NADH-quinone oxidoreductase subunit E (nuoE) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 84% identity to mmb:Mmol_1602)

MetaCyc: 38% identical to NADH-quinone oxidoreductasesubunit E (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Protein Sequence (159 amino acids)

>GFF944 NADH-quinone oxidoreductase subunit 2 (Methylophilus sp. DMC18)
MLSAESIEKIEYELSKYPADRRQAAVMSALRIVQMERGWLSKESISEVAKYLRIPEIAAL
EVATFYNMYDLEPVGKYKITVCTNISCMLRGSDEIVEHLQHKLGVGFNEVTADGKFCLKE
GECMGCCGGAPLLHVNNSEMHEFLTTEKVDALINELNKG