Protein Info for GFF941 in Xanthobacter sp. DMC5

Annotation: L-lysine 2,3-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR03822: lysine-2,3-aminomutase-related protein" amino acids 19 to 337 (319 residues), 526.3 bits, see alignment E=2.6e-162 TIGR00238: KamA family protein" amino acids 34 to 326 (293 residues), 261 bits, see alignment E=1.4e-81 PF04055: Radical_SAM" amino acids 112 to 262 (151 residues), 39.4 bits, see alignment E=1.1e-13 PF13353: Fer4_12" amino acids 113 to 180 (68 residues), 24.3 bits, see alignment E=5e-09 PF12544: LAM_C" amino acids 306 to 341 (36 residues), 31.6 bits, see alignment 2.5e-11

Best Hits

KEGG orthology group: K01843, lysine 2,3-aminomutase [EC: 5.4.3.2] (inferred from 79% identity to xau:Xaut_3908)

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF941 L-lysine 2,3-aminomutase (Xanthobacter sp. DMC5)
MPNPLNKLVSLAARDQGTLRTPADLIGAGLATPEHRAALEAVAAQYAVAVTPTLAAAIDT
TDAADPIARQFVPDAAELKVRPEELADPIGDDAHSPVPGVVHRYPDRALLKIVGVCAVYC
RFCFRREMVGPGAASLLSDDALEQAFAYFAQHPEIWEVILTGGDPFMLSARRMGEVVGRL
AAIPHVKIVRHHTRVPIAAPERVTPAFVAALKAPGITPYVAVHVNHARELTPAARAAMAR
LADAGIPLLSQTVLLRGVNDDAGTLAELFRALVECRVKPYYLHHPDLAPGTGHFRLPIAE
GQALVRALRGRMSGIAQPTYVLDIPGGAGKVPLTPGHLAAAEGGYQVSDNCGGLHAYADE
GTNG