Protein Info for GFF940 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details PF00892: EamA" amino acids 22 to 152 (131 residues), 49 bits, see alignment E=3.8e-17 amino acids 163 to 297 (135 residues), 64 bits, see alignment E=9.2e-22

Best Hits

KEGG orthology group: None (inferred from 85% identity to vap:Vapar_2135)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF940 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MSTLASPAGAASAARSGLPPLLWLCLAATWLVWGSTYLAIKYALVSFPPFLQMGSRFLCA
GVLLAVWMRWRGAPWPSPVQWRNAFVVGALMLGGGMGGTAHAEVSIGSGLVVAFIAVIPL
LIALLNLIWGVKPSRLEAAGIALGLVGVLMLTQGNGFRSSPEGLLAICIACVCWSLGSVL
SQRSLPLAPGAMGFASEMLCGGVVLMGLAAVSGETMSWPLRAEAAAAWVYLVVFGSLIAF
NAYMVLLARAPAALASSYTFVNPVIAMLLGVWIANETVTRFEWYAVGVVLAGVLLLLLRR
RA