Protein Info for GFF940 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ornithine carbamoyltransferase (EC 2.1.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00658: ornithine carbamoyltransferase" amino acids 8 to 332 (325 residues), 451 bits, see alignment E=9.5e-140 PF02729: OTCace_N" amino acids 8 to 147 (140 residues), 166.2 bits, see alignment E=5.4e-53 PF00185: OTCace" amino acids 156 to 330 (175 residues), 179.5 bits, see alignment E=5.1e-57

Best Hits

Swiss-Prot: 100% identical to OTC_SALTY: Ornithine carbamoyltransferase (argI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to see:SNSL254_A4817)

MetaCyc: 90% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF940 Ornithine carbamoyltransferase (EC 2.1.3.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSTFYQKPFLKLLDFTASELTALLQLAAKLKADKKNGKEEQKLVGKNIALIFEKDSTRTR
CSFEVAAYDQGARVTYLGSSGSQIGHKESIKDTARVLGRMFDGIQYRGYGQEIVETLAEY
SGVPVWNGLTDEYHPTQLLADLLTMQEHLPGKAFNEMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPKACWPQAALVAECSAMAKKNGGAITLTEDIASGVKGADFIYTDVWVSMGEP
KEKWAERIALLRDYQVNSQMMALTGNPQVKFLHCLPAFHDDETTLGKKMAEEYGLHGGME
VTDEVFESAASIVFDEAENRMHTIKAVMVATLSK