Protein Info for GFF932 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF21102: DprA_N" amino acids 22 to 85 (64 residues), 82.1 bits, see alignment E=2.7e-27 TIGR00732: DNA protecting protein DprA" amino acids 84 to 298 (215 residues), 222 bits, see alignment E=2.7e-70 PF02481: DNA_processg_A" amino acids 93 to 299 (207 residues), 239.1 bits, see alignment E=4.5e-75 PF17782: WHD_DprA" amino acids 321 to 373 (53 residues), 58.3 bits, see alignment 9.8e-20

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 81% identity to xau:Xaut_3916)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF932 hypothetical protein (Xanthobacter sp. DMC5)
MVRGRASGPASGPANGELLGPEQRRDWLRLIRTENVGPRTFRALINQFGGAGAALEALPS
LARRGGRLMPPHTPTLAEVDAELEAHARMGARLVALGERDYPPALAALDDAPPLISVRGE
AEVLRRPMVGIVGARNASAAGRTFAARLARDLAAGGWVVVSGLARGIDAAAHEASLDGGT
VGVFAGGLAKPYPPENLGLMDKVAATGALVSEMPIGWEPRARDFPRRNRLVSGMSLGVVV
VEAAERSGSLITARLAAEQGREVFAVPGSPLDPRAGGTNRLLKRGATLVTEAADIIEVLT
PIAGRRDDPVVEAEAPFVPAGPVTPGDDARARVISLLGPVPTPIDDLVRLSGCTVAEVQI
VLLELELAGRLDRPGTGRVALK