Protein Info for GFF931 in Methylophilus sp. DMC18

Annotation: tRNA-specific adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14437: MafB19-deam
  • amino acids 1 to 148 (148 residues), 140.8 bits, E=3e-45
• PF00383: dCMP_cyt_deam_1
  • amino acids 2 to 100 (99 residues), 106.7 bits, E=5.2e-35

Best Hits

Swiss-Prot: 54% identical to TADA_SHIFL: tRNA-specific adenosine deaminase (tadA) from Shigella flexneri

KEGG orthology group: None (inferred from 79% identity to mmb:Mmol_0729)

MetaCyc: 54% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Protein Sequence (154 amino acids)

>GFF931 tRNA-specific adenosine deaminase (Methylophilus sp. DMC18)
MQDEAFMRIAIALANEAANLGEVPVGAIVVKEGQIIGKGRNAPISLNDPTAHAEIQAMRE
AAQHLGNYRLVGCTLYVTLEPCAMCSGAIQHARIARLVYGASDPKTGCCGSVVNLMAEQK
LNHHCVVSHGVLADECGALLSDFFRQRRLAKSNG