Protein Info for GFF930 in Xanthobacter sp. DMC5

Annotation: Dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 53 to 442 (390 residues), 325.2 bits, see alignment E=3.2e-101 PF12890: DHOase" amino acids 69 to 256 (188 residues), 104.1 bits, see alignment E=1.3e-33 PF01979: Amidohydro_1" amino acids 73 to 439 (367 residues), 66.1 bits, see alignment E=5.4e-22

Best Hits

Swiss-Prot: 39% identical to PYRC_GEOSM: Dihydroorotase (pyrC) from Geobacter sp. (strain M21)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 89% identity to xau:Xaut_3918)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF930 Dihydroorotase (Xanthobacter sp. DMC5)
MRNGRTTAQVSRAHDPRPLLLANARVIDPSRGADFHGDVFLADGVVKDAGFGIAAAGIPD
GAEVVECAGAVVAPGLVDMRAFVGEPGAEHRETLASASHAAAAGGVTTIICQPDTDPAVD
DPAIVDFILRRARDTAVVRVHPMAAITKGLEGHEMTEIGLLQAAGAVAFTDGHKSIMNAQ
VLRRALTYARDFDALLVHHTEDASMSQGAMNEGAFATRLGLSGNPKAAETIILERDVRLV
GAARSRYHAAALTCAESLEVLERAKEAGLPVTASVSINHLSFNELDIGAYRTYFRLAPPL
RGEEDRQALIRALASGLLDVVVSDHLPQDVEGKRLPFSEAEPGAIGLETLLSAALRLVHS
DQVDLVNLLAALSTRPAQILGLDAGTLRPGAAADVIVFDPGMPYVLDPRSLKSRCRNTPF
DEARLDGRVLRTIVAGQTVYEYV