Protein Info for GFF930 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Butyryl-CoA dehydrogenase (EC 1.3.99.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF02771: Acyl-CoA_dh_N" amino acids 11 to 121 (111 residues), 99.7 bits, see alignment E=2.7e-32 PF02770: Acyl-CoA_dh_M" amino acids 126 to 222 (97 residues), 91.4 bits, see alignment E=6.8e-30 PF00441: Acyl-CoA_dh_1" amino acids 234 to 390 (157 residues), 141.2 bits, see alignment E=5.9e-45 PF08028: Acyl-CoA_dh_2" amino acids 250 to 373 (124 residues), 62.8 bits, see alignment E=8.2e-21

Best Hits

KEGG orthology group: None (inferred from 64% identity to cti:RALTA_A2851)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF930 Butyryl-CoA dehydrogenase (EC 1.3.99.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAATRSFALSADDRAVLEAADKFARKEFVPLARRMDDEEWWPSDIFQKIGAAGFMGATVP
AEHGGAGMDLFSSGLICQAFARWNPAIALSWAAHDNLCVNNIFRNANEAQRRQYLPDLCN
GTKIGALGLTEPGAGSDALGAMRTSARREGDHYILNGTKIYITNGPVADVLLVYAKTAPE
LGAKGISAFIVEKNFPGFKVAQKLIKMGFRGSQTGELVFDNCRVPAANLVGKENEGVKIV
MSGLDLERALVAGLCVGICERALELSVEYARTRVQFGKPIGSFQMVQAMLAEMYTEIEAM
KTLVWRTLAEVNDLEVGGGGRGDVHKLTAASILYAGEACNRVLNKAVQVHGGSGYIWESE
INRLFRCIKILEIGAGTSEVRKMIIAEELLRG