Protein Info for GFF930 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Aspartate carbamoyltransferase (EC 2.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR00670: aspartate carbamoyltransferase" amino acids 8 to 305 (298 residues), 412.3 bits, see alignment E=5.5e-128 PF02729: OTCace_N" amino acids 8 to 148 (141 residues), 163.1 bits, see alignment E=5e-52 PF00185: OTCace" amino acids 155 to 303 (149 residues), 104.3 bits, see alignment E=6.9e-34

Best Hits

Swiss-Prot: 100% identical to PYRB_SALTY: Aspartate carbamoyltransferase catalytic subunit (pyrB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to sei:SPC_4592)

MetaCyc: 95% identical to aspartate carbamoyltransferase catalytic subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.2

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF930 Aspartate carbamoyltransferase (EC 2.1.3.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GQVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHIAMVGDLKYGRTVHSLTQALAKF
SGNRFYFIAPDALAMPQYILDMLDEKGMAWSLHGSIEEVMADVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLNGARENMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELSL