Protein Info for GFF929 in Xanthobacter sp. DMC5

Annotation: Aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00670: aspartate carbamoyltransferase" amino acids 12 to 308 (297 residues), 301 bits, see alignment E=4.2e-94 PF02729: OTCace_N" amino acids 12 to 154 (143 residues), 147.9 bits, see alignment E=2.4e-47 PF00185: OTCace" amino acids 161 to 307 (147 residues), 82.1 bits, see alignment E=4.6e-27

Best Hits

Swiss-Prot: 93% identical to PYRB_XANP2: Aspartate carbamoyltransferase (pyrB) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 93% identity to xau:Xaut_3919)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF929 Aspartate carbamoyltransferase (Xanthobacter sp. DMC5)
MQDASAFTLSGRDLIGIEGLSAGEITGLLDLAEEFVELNRQIEKKRTTLRGRTQINLFFE
ASTRTQSSFEIAGKRLGADVMNMSVASSSVKKGETLIDTAITLNAMHPDILVVRHHASGA
VALLARKVDCCVVNAGDGAHEHPTQALLDALTIRRNKGRIQGLTVAICGDVLHSRVARSN
IALLNTMGAKVRVVAPSTLLPSGVETLGVEVFRTMEAGLEGADIVMMLRLQRERMAGSFI
PSVKEYFHYFGLDEAKLRYAAPDALVMHPGPMNRGVEIDSAIADGAQSLIREQVEMGVAV
RMAVLDSLARKLPNA