Protein Info for GFF925 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 88 to 199 (112 residues), 35.6 bits, see alignment E=2.9e-12 PF12146: Hydrolase_4" amino acids 89 to 205 (117 residues), 53.6 bits, see alignment E=7.3e-18 PF12697: Abhydrolase_6" amino acids 90 to 275 (186 residues), 48.3 bits, see alignment E=7.3e-16 PF00326: Peptidase_S9" amino acids 107 to 275 (169 residues), 25.4 bits, see alignment E=3.2e-09 PF03959: FSH1" amino acids 161 to 272 (112 residues), 23.7 bits, see alignment E=1.3e-08

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 91% identity to pfo:Pfl01_1951)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF925 hypothetical protein (Pseudomonas sp. DMC3)
MFLSLLTRLRRRRLAFAMMAALIIGVPTSCAVLEHTERKLLFRIEPGTAGWYRGLPGSVQ
ELDLQPKSFKAGQNIHAWWWPAERANAPAILYLHGVRWNLTGQLFRIEQLRAAGYSVLAI
DYRGFGQSKGDLPSESSVYEDARVAWERFQLLQPDPNKRLIYGHSLGGAVAIDLAAELGQ
NAARNHTPLPVRGLVIESTFTSLADVAAAVANTSLPVRWLLSQKFDSIDKIADIHMPLLV
VHGLADAFVPPRFSEQLFNAAEQPKRLLLVPGATHNNSMALGGQGYRKALDALMQSKPLP
RVAGPAVAKGSGDS