Protein Info for PS417_04685 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 5 to 453 (449 residues), 438.6 bits, see alignment E=1.5e-135 PF00512: HisKA" amino acids 238 to 302 (65 residues), 53 bits, see alignment E=4.2e-18 PF14501: HATPase_c_5" amino acids 347 to 450 (104 residues), 26.5 bits, see alignment E=7.7e-10 PF02518: HATPase_c" amino acids 348 to 453 (106 residues), 85.2 bits, see alignment E=6.5e-28

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 92% identity to pfs:PFLU0958)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UD35 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PS417_04685 histidine kinase (Pseudomonas simiae WCS417)
MSANSIALRLSSMFTLVALLIFLLIGGALYQQVDRSLGLLPGAELDARYSVLESSVNRFG
TPDHWVKIQAKLKLLGEEDKRIRFWVVSSDPNYEYGNPDAQIRAFAEGPTGKRDLRLPGR
EYPLKVLVSQFPAKDQRPPLRFMIAIDTENFRATQHHLLVALVALSLVGVVLASLLGFWV
ARIGLKPLGKLSDEAQKLAPPKLSGRLQLSPLPPELSQFVNSFNSTLDRVEQAYSRLESF
NADVAHELRSPLTNLIGQTQVALTRGRSAEHYFEVLQSNLEELERLRSIINDMLFLASAD
QGSKATKLTESSLADEVATTLDYLDFILEDAQVTVQVRGDARVQIEKAHLRRALINLLSN
AVQHTAPDQVIVVSIERQDHQVAIGVTNPGDAIASEHLPRLFERFYRVDASRSNSGANHG
LGLAIVKAIALMHGGDVFVRSDGGGNTFGITLPV