Protein Info for GFF923 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 108 to 130 (23 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details PF00367: PTS_EIIB" amino acids 12 to 40 (29 residues), 45.7 bits, see alignment 1.8e-16 TIGR00826: PTS system, glucose-like IIB component" amino acids 30 to 111 (82 residues), 60.4 bits, see alignment E=8.5e-21

Best Hits

Predicted SEED Role

"PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69)" in subsystem Trehalose Uptake and Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>GFF923 PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSKVKQADIDRLIDLVGGRDNIATVSHCITRLRFVLHQPANARPKEIEQLPMVKGCFTNA
GQFQVVIGTDVGDYYNALLETTGKAYADKEQAKKAARQNMKWHEQLISHFAEIFFPLLPA
LISGGLILGFRNVIGDVPMSNGQTLAQMHPALKTLYDFLWLIGEAIFFYLPVGICWSAVK
KWAARRFLVSCSA