Protein Info for PS417_04660 in Pseudomonas simiae WCS417

Annotation: cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR01174: cell division protein FtsA" amino acids 9 to 378 (370 residues), 525.8 bits, see alignment E=3.1e-162 PF14450: FtsA" amino acids 11 to 180 (170 residues), 36.5 bits, see alignment E=1.2e-12 amino acids 207 to 374 (168 residues), 138.3 bits, see alignment E=3.7e-44 PF02491: SHS2_FTSA" amino acids 85 to 162 (78 residues), 112.7 bits, see alignment E=1.7e-36 PF06723: MreB_Mbl" amino acids 170 to 351 (182 residues), 56.7 bits, see alignment E=3.6e-19

Best Hits

Swiss-Prot: 91% identical to FTSA_PSEAE: Cell division protein FtsA (ftsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03590, cell division protein FtsA (inferred from 100% identity to pfs:PFLU0951)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAG0 at UniProt or InterPro

Protein Sequence (420 amino acids)

>PS417_04660 cell division protein FtsA (Pseudomonas simiae WCS417)
MANVQSGKMIVGLDIGTSKVVALVGEVGEDGVIEIVGIGTHPSRGLKKGVVVNIESTVQS
IQRAIEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA
IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL
EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT
NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR
YDELFTLIQAELRRSGYEDLIPAGIVLTGGTSKMEGAVELAEEIFHMPVRLGVPHGVKGL
GDVVRNPIYSTGVGLLLYGLQKQTDGISLSGPSNRDSYRSDDEAKAPLFERLQAWVKGNF