Protein Info for GFF915 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 57.8 bits, see alignment E=1.2e-19 PF00528: BPD_transp_1" amino acids 113 to 312 (200 residues), 139 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 42% identical to Y1092_BRUSU: Putative peptide transport system permease protein BRA1092/BS1330_II1084 (BRA1092) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 71% identity to bra:BRADO2618)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF915 ABC transporter, permease protein 1 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MFAYLLRRIAMTIPTLLLVSIAVFTLMRLIPGDPVLLMLGEGADPAQLALMRHQMGLDQP
LPVQYLVWLRHALTGDLGVSTTNGLAVLPLIWERFQVSAVIVLVAVALASLIAVPAGLVA
AWRKDKPTDLAIIGAATLMLSVPSFWLGLLLLMFFGQYLGWLPVVGYVPMSENFSQGVLY
VILPIATLLLVETGVLTRMSRASTIEILRLEYVTHARAKGVPESQVLRRHVLPNAFNPTL
TMIGLILGHLLSGIAVLETVFTLPGLGRLMIDSIFARDYPVLQGCLLFTACIYVVINLVV
DLCYPLFDPRVSVQ