Protein Info for GFF907 in Xanthobacter sp. DMC5

Annotation: Aliphatic amidase expression-regulating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 36 to 385 (350 residues), 242.8 bits, see alignment E=8.3e-76 TIGR03407: urea ABC transporter, urea binding protein" amino acids 37 to 402 (366 residues), 567.9 bits, see alignment E=4e-175 PF13433: Peripla_BP_5" amino acids 37 to 405 (369 residues), 538.7 bits, see alignment E=7.3e-166

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 92% identity to xau:Xaut_4149)

Predicted SEED Role

"Urea ABC transporter, urea binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF907 Aliphatic amidase expression-regulating protein (Xanthobacter sp. DMC5)
MLGLLGRTTRRGFGALAAAAVVAGTMGVGAARAEDTIKVGILHSLSGTMAISETTLKDVM
LMLIEEQNKKGGLLGKKLEAVVVDPASNWPLFAEKARELITKDKVAAVFGCWTSVSRKSV
LPVFKELNNILFYPVQYEGEESERNVFYTGAAPNQQAIPAVDYLANEEKVERWVLAGTDY
VYPRTTNKILEAYLKSRGVKAEDIMINYTPFGHSDWQTIVSDIKKFGSAGKKTAVVSTIN
GDANVPFYKELANQGIKATDIPVVAFSVGEEELAGIDTKPLLGHLAAWNYFMSIDTPENK
AFIDKWHAFTKNPKRVTNDPMEAHYIGFNMWVKAVEKAGTTDPDKVIATLPGIQQANLTG
GVSQMLPNHHITKPVFIGEIKDNGQFDVVWKTKDLIPGEAWSKYLEGSKNLVADWVKYNC
GNYDTTTNKCLGAAAK