Protein Info for GFF907 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 2,3-dihydroxybenzoate-AMP ligase (EC 2.7.7.58)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 235 to 251 (17 residues), see Phobius details amino acids 270 to 284 (15 residues), see Phobius details PF00501: AMP-binding" amino acids 28 to 402 (375 residues), 221.3 bits, see alignment E=1.9e-69 PF13193: AMP-binding_C" amino acids 453 to 530 (78 residues), 56.2 bits, see alignment E=5.5e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>GFF907 2,3-dihydroxybenzoate-AMP ligase (EC 2.7.7.58) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MILHTAETLKRYTESGHWGRRTLLDLLRETAAKAPERPAVVDPADRPDLTGTAAQNLSYR
EFAAAVDAIATGLLDMGLRKDEIVVVQLPNVWELVAMFLAVSRAGGVLSPMPIQWRDNEF
QNVKKLTEARFFFGMRDFKGADQLAIAEKTGFVALPIERIAEMARGAADVARLDAIGVDA
NDIFSLCWSSGTEALSKGCPMSHNNWLFQMNLIPLTAGLHEGDRVLATAPVVNMTGVATW
LASLAIGGTTLLHHPLNMPLLLKQLMHDQVHFTLLVPALLNMILKLPNVDQLDFSSVRCI
ASGSAQPSRWSMEEFKRRWNIEILHAWGQTEGTAVFAGARDVPDFAKRADHFPWWGRPGV
EWPSDIQGVEMKLLDESGAECTQPGQVGELVYRGPNVFAGYYQRPDLAISTFTPDGFCRT
GDFFIVRDVHHIGFFDRKKDIIIRGGFNVSAAEVENLVLTHPGVQEVAAVAVPDEIMGEK
TCIFVVPKDKAQPPALEDIVGHLKQIGVAAYKLPERIEYLDAIPRNPVGKILKAELRKHL
RPAAA