Protein Info for GFF905 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 47 to 91 (45 residues), see Phobius details amino acids 94 to 94 (1 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 37 to 352 (316 residues), 460.1 bits, see alignment E=2.6e-142 PF02653: BPD_transp_2" amino acids 47 to 341 (295 residues), 144.6 bits, see alignment E=1.6e-46

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 91% identity to xau:Xaut_4151)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF905 hypothetical protein (Xanthobacter sp. DMC5)
MNRTRIIDRTGGIFLIAVLAAGVLIPASNLLLPAGNPLHVPDYMIPLLGKYLCYALLAVA
VDLVWGYCGVLSLGHGAFFALGGYAMGMYLMRQIGARGVYGNPVLPDFMVFLNYKELPWF
WEGFNIFPFAMLMVVLVPGALAFVFGWFAFRSRVTGVYLSIITQAMTFALMLAFFRNDMG
FGGNNGLTDFKDILGFPISAPSTRLVLFVLSAAALAAGYVLCRALVTSKYGKVLVAVRDA
ESRTRFLGYRVENYKLVAWVFSAMLAGVAGALYVPQVGIINPSEFAPAQSIEMVIWVAVG
GRGTLVGAALGALIVNAGKTWFTGVLPEAWLFALGALFVLVTLFLPKGVLGLAASLSEKW
KARRPSSAPTPSATPAE