Protein Info for GFF904 in Sphingobium sp. HT1-2

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00106: adh_short" amino acids 10 to 198 (189 residues), 129.7 bits, see alignment E=1.4e-41 PF08659: KR" amino acids 10 to 186 (177 residues), 59.6 bits, see alignment E=6.1e-20 PF13561: adh_short_C2" amino acids 15 to 240 (226 residues), 107.5 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 44% identity to tcu:Tcur_2712)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF904 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Sphingobium sp. HT1-2)
MDRIDFTGRTILITGAGGGLGRAYARDIAARGGAVIVNDLGGSVTGKGASATMADAVVAE
IVAAGGIAIANGDDVSSPDGAQAMIDLAIARFGRIDAVIANAGNMRFAPVEDLTAADLDA
LLAVHVRGAFNVARAAWPHMRAQGGGRLVLTTSGGGMLGMGQLSAYGAAKGGVMGLMHNL
AEEGRPHGILCNAIMPNAASRMSAGMSEGTLGHNPWGRALGPSFDPRFTAGLVAYLAHER
CTSTHSIYSALGGRIARVFVGATTGWDHGLDAPPTAEDVAAHIDRIRDDGAGYAIPADIF
DEFRIVAEGRG