Protein Info for GFF903 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Succinate dehydrogenase/fumarate reductase, flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 PF01266: DAO" amino acids 7 to 59 (53 residues), 34.5 bits, see alignment 3.4e-12 PF00890: FAD_binding_2" amino acids 7 to 546 (540 residues), 327.8 bits, see alignment E=2.6e-101 PF12831: FAD_oxidored" amino acids 7 to 110 (104 residues), 39.9 bits, see alignment E=7.1e-14 PF13450: NAD_binding_8" amino acids 10 to 45 (36 residues), 24.3 bits, see alignment 6.2e-09

Best Hits

KEGG orthology group: None (inferred from 81% identity to axy:AXYL_06716)

Predicted SEED Role

"Succinate dehydrogenase/fumarate reductase, flavoprotein subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>GFF903 Succinate dehydrogenase/fumarate reductase, flavoprotein subunit (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEKIECDVLVAGSGAAGLTAAFTAADSGLDVIVAEKEPVFGGTTAYSAGVIWIPGNSLAR
QAGLKDSPEDALTYMKEEAGEFFDEPKARAFVENAPRMLDHMLARSHVRYQLIPNWADYH
PLRPGASSGGRSLLPEPFDGRRLGQRFRELRVPITTMMLFGGMSVSRSDIPHLFNATRSL
RSGVHVLCMLARYARDRLSWPRGTAIANGNALVARLALSLFEKGVPLWTGSPLVRLIEQD
GRVSGGLVRRDGRTVEVVARKGVILASGGFPRNDAWRRERYPHVAQGKNHVSLAPPGNTG
DGAQLAQAHGAGFSKGASNPAAWTPVSNLPNGDGTFTPYPHFIDRCKPGFIAVDRRGQRF
ANEADSYHDFVPAMVKACANDARVEAFLICDHATIRRYGMGVVPPFPMPITRYVDRGYLI
RGDTLAGLASQLGIEPAALDSTVKRYNGFARDGKDLDFGKGSNVYNHFGGDPSCKPNPNL
APIERGPFYAVRLEPSDLGTFQGLQTDEHARVLRATDGTPIQGLYAVGNDMASVMGGAYP
GAGITIGPAMTFAYIAARHLDT